ZNF780A Blocking Peptide (33R-10366)

A synthetic peptide for use as a blocking control in assays to test for specificity of ZNF780A antibody, catalog no. 70R-7938

Synonyms ZNF780A control peptide, ZNF780A antibody Blocking Peptide, Anti-ZNF780A Blocking Peptide, zinc finger protein 780A Blocking Peptide, ZNF780 Blocking Peptide, ZNF780A, ZNF-780A, ZNF 780A, ZNF-780A Blocking Peptide, ZNF 780A Blocking Peptide
Protein Type Synthetic
Applications IHC, WB

Specifications

Residues MLENYSHLISLGSSISKPDVITLLEQEKEPWMVVRKETSRRYPDLELKYG
Molecular Weight 70 kDa
Form & Buffer Lyophilized powder. Add 100ul of distilled water for a final peptide concentration is 1 mg/ml.

Storage & Safety

Storage Store at -20 deg C long term. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZNF780A belongs to the krueppel C2H2-type zinc-finger protein family. It contains 17 C2H2-type zinc fingers and 1 KRAB domain. ZNF780A may be involved in transcriptional regulation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: $130.00
Size: 100 ug
OR
Shipping
View Our Distributors