ZP1 antibody (70R-7060)

Rabbit polyclonal ZP1 antibody

Synonyms Polyclonal ZP1 antibody, Anti-ZP1 antibody, ZP1, ZP-1 antibody, ZP-1, Zona Pellucida Glycoprotein 1 antibody, ZP 1, ZP 1 antibody, Sperm Receptor antibody, MGC87693 antibody
Cross Reactivity Human
Applications WB
Immunogen ZP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TLEHWDVNKRDYIGTHLSQEQCQVASGHLPCIVRRTSKEACQQAGCCYDN
Assay Information ZP1 Blocking Peptide, catalog no. 33R-9168, is also available for use as a blocking control in assays to test for specificity of this ZP1 antibody


Western Blot analysis using ZP1 antibody (70R-7060)

ZP1 antibody (70R-7060) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 70 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZP1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The mammalian zona pellucida, which mediates species-specific sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy, is composed of three to four glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP1 ensures the structural integrity of the zona pellucida.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using ZP1 antibody (70R-7060) | ZP1 antibody (70R-7060) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $375.00
Size: 50 ug
View Our Distributors