ZP2 antibody (70R-1732)

Rabbit polyclonal ZP2 antibody

Synonyms Polyclonal ZP2 antibody, Anti-ZP2 antibody, Zona Pellucida Glycoprotein 2 antibody, ZP-2 antibody, ZPA antibody, ZP 2 antibody, ZP-2, Sperm Receptor antibody, ZP2, ZP 2
Cross Reactivity Human
Applications WB
Immunogen ZP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PDSFPQWNVVVDGCAYDLDNYQTTFHPVGSSVTHPDHYQRFDMKAFAFVS
Assay Information ZP2 Blocking Peptide, catalog no. 33R-7023, is also available for use as a blocking control in assays to test for specificity of this ZP2 antibody

Western Blot analysis using ZP2 antibody (70R-1732)

ZP2 antibody (70R-1732) used at 2.5 ug/ml to detect target protein.

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of ZP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. ZP2 is a structural component of the zona pellucida and functions in secondary binding and penetration of acrosome-reacted spermatozoa. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a consensus furin cleavage site, and a C-terminal transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western Blot analysis using ZP2 antibody (70R-1732) | ZP2 antibody (70R-1732) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: $275.00
Size: 100 ug
View Our Distributors