ZPBP2 antibody (70R-4044)

Rabbit polyclonal ZPBP2 antibody raised against the middle region of ZPBP2

Synonyms Polyclonal ZPBP2 antibody, Anti-ZPBP2 antibody, ZPBP-2 antibody, ZPBP2, ZPBP 2 antibody, Zona Pellucida Binding Protein 2 antibody, ZPBP 2, ZPBP-2, MGC41930 antibody, ZPBPL antibody
Specificity ZPBP2 antibody was raised against the middle region of ZPBP2
Cross Reactivity Human
Applications WB
Immunogen ZPBP2 antibody was raised using the middle region of ZPBP2 corresponding to a region with amino acids VRLDSCRPGFGKNERLHSNCASCCVVCSPATFSPDVNVTCQTCVSVLTYG
Assay Information ZPBP2 Blocking Peptide, catalog no. 33R-9776, is also available for use as a blocking control in assays to test for specificity of this ZPBP2 antibody

Images

Western Blot analysis using ZPBP2 antibody (70R-4044)

ZPBP2 antibody (70R-4044) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZPBP2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZPBP2 may be implicated in gamete interaction during fertilization.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ZPBP2 antibody (70R-4044) | ZPBP2 antibody (70R-4044) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors