ZPLD1 antibody (70R-7542)

Rabbit polyclonal ZPLD1 antibody raised against the C terminal of ZPLD1

Synonyms Polyclonal ZPLD1 antibody, Anti-ZPLD1 antibody, Zona Pellucida-Like Domain Containing 1 antibody, ZPLD-1 antibody, ZPLD-1, ZPLD 1 antibody, ZPLD1, ZPLD 1
Specificity ZPLD1 antibody was raised against the C terminal of ZPLD1
Cross Reactivity Human,Mouse
Applications WB
Immunogen ZPLD1 antibody was raised using the C terminal of ZPLD1 corresponding to a region with amino acids DAGRRTTWSPQSSSGSAVLSAGPIITRSDETPTNNSQLGSPSMPPFQLNA
Assay Information ZPLD1 Blocking Peptide, catalog no. 33R-1851, is also available for use as a blocking control in assays to test for specificity of this ZPLD1 antibody

Images

Western Blot analysis using ZPLD1 antibody (70R-7542)

ZPLD1 antibody (70R-7542) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZPLD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of ZPLD1 has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ZPLD1 antibody (70R-7542) | ZPLD1 antibody (70R-7542) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors