ZRSR2 antibody (70R-4763)

Rabbit polyclonal ZRSR2 antibody

Synonyms Polyclonal ZRSR2 antibody, Anti-ZRSR2 antibody, ZRSR-2, ZRSR 2, Ccch Type Rna-Binding Motif And Serine/Arginine Rich 2 antibody, U2AF1-RS2 antibody, MGC142014 antibody, ZRSR 2 antibody, U2AF1RS2 antibody, URP antibody, U2AF1L2 antibody, ZRSR-2 antibody, MGC142040 antibody, Zinc Finger antibody, ZRSR2
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen ZRSR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LKEQWEEQQRKEREEEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNP
Assay Information ZRSR2 Blocking Peptide, catalog no. 33R-5084, is also available for use as a blocking control in assays to test for specificity of this ZRSR2 antibody

Images

Western Blot analysis using ZRSR2 antibody (70R-4763)

ZRSR2 antibody (70R-4763) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 58 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZRSR2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance ZRSR2 is an essential splicing factor. The protein associates with the U2 auxiliary factor heterodimer, which is required for the recognition of a functional 3' splice site in pre-mRNA splicing.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ZRSR2 antibody (70R-4763) | ZRSR2 antibody (70R-4763) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors