ZSWIM3 antibody (70R-3646)

Rabbit polyclonal ZSWIM3 antibody raised against the N terminal of ZSWIM3

Synonyms Polyclonal ZSWIM3 antibody, Anti-ZSWIM3 antibody, ZSWIM 3 antibody, ZSWIM3, ZSWIM 3, C20orf164 antibody, ZSWIM-3, Zinc Finger Swim-Type Containing 3 antibody, ZSWIM-3 antibody
Specificity ZSWIM3 antibody was raised against the N terminal of ZSWIM3
Cross Reactivity Human
Applications WB
Immunogen ZSWIM3 antibody was raised using the N terminal of ZSWIM3 corresponding to a region with amino acids SVRFHNLNHGTSIREDILYVQVKFVCIRTQSNRKRTREADMCPAYLLLRY
Assay Information ZSWIM3 Blocking Peptide, catalog no. 33R-8928, is also available for use as a blocking control in assays to test for specificity of this ZSWIM3 antibody

Images

Western Blot analysis using ZSWIM3 antibody (70R-3646)

ZSWIM3 antibody (70R-3646) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 77 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ZSWIM3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of ZSWIM3 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using ZSWIM3 antibody (70R-3646) | ZSWIM3 antibody (70R-3646) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: $345.00
Size: 50 ug
OR
Shipping
View Our Distributors